PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_32428
Common NameKK1_034566
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 269aa    MW: 31132 Da    PI: 5.7297
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_32428genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.51.8e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +l++ +   G ++W+t+++  g+ R++k+c++rw +yl
    C.cajan_32428 14 RGPWTIEEDHKLINFILNNGIHCWRTVPKLAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding50.93.6e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +T+ E++++++++  lG++ W++Ia++++ gRt++++k++w++
    C.cajan_32428  67 RGGFTEKEEDQIIQLHSCLGNR-WSKIASHFP-GRTDNEIKNHWNT 110
                      788*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-21564IPR009057Homeodomain-like
PROSITE profilePS5129413.81961IPR017930Myb domain
SuperFamilySSF466891.57E-2811108IPR009057Homeodomain-like
SMARTSM007171.7E-71363IPR001005SANT/Myb domain
PfamPF002492.3E-121461IPR001005SANT/Myb domain
CDDcd001672.49E-51661No hitNo description
PROSITE profilePS5129424.72162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.1E-2565116IPR009057Homeodomain-like
SMARTSM007177.9E-1566114IPR001005SANT/Myb domain
PfamPF002498.5E-1567110IPR001005SANT/Myb domain
CDDcd001675.21E-1070110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MGRQPCCDKV GLKRGPWTIE EDHKLINFIL NNGIHCWRTV PKLAGLLRCG KSCRLRWINY  60
LRPDLKRGGF TEKEEDQIIQ LHSCLGNRWS KIASHFPGRT DNEIKNHWNT KIKKRLKFLG  120
VDPMTLKPIE QKEQSGDDKN MTDQQQKNTS KGSEQGVENM SLDMTKTEGK MEENKVMTWD  180
DTTDFSNYEM LCSQLDLGSW MSQETKTSTT SSYCSSSFSL DDSSNLSMDE SSYLQENSLQ  240
QWVDGFDSIL PWDSFNPLEK DFLFLDNRQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150448e-62AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003555012.11e-154PREDICTED: myb-related protein 315-like
SwissprotP813942e-78MYB15_ANTMA; Myb-related protein 315
TrEMBLA0A151RN490.0A0A151RN49_CAJCA; Myb-related protein 315 family
STRINGGLYMA19G07830.11e-154(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66253150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.13e-84myb domain protein 40